DPCstruct | MC38910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 70.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059BDG5 | 1-69 | MLACNYLNTQEDLDTIDRLIADAEASYNKWRHPDPYIVPWAPGGSKFTRNPTPPSGIEIIYDYGREDND |
| M0YJS4 | 14-72 | NVENLDVIDRLIEDAEAQQRNFQHPDPYIVPWAPGGTKFTRNPPPPEGIEIIYNYGKED |
| A0A454XQ28 | 37-95 | None |
| A0A251TJF7 | 51-109 | None |
| A0A0A9LHS7 | 1-55 | None |
| A0A7J6G033 | 45-104 | None |
| A0A3N7EVM8 | 1-51 | None |
| A0A2U1M727 | 31-90 | None |
| A0A200R8C7 | 1-54 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.