DPCstruct | MC38908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 5.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059B3B5 | 1-69 | MGNEVLGEKAVKMNNLCLYPIKPIRSGEGLPYAPVDWPNLGDIWYWWLGNRTYHFGFYQDRFLYLPNHL |
| A0A6P6WZ84 | 3-82 | TDVSKAGHDCRPLKRKSEVLTSPVPPGASGKGLPYAPVDWPNVGDIWGWRVGTRVRVAGFYNDRFLYAPQRLQKKPTRKL |
| A0A067G4M6 | 1-72 | None |
| A0A2Z6PHN7 | 2-68 | None |
| A0A2Z6PFV2 | 3-73 | None |
| A0A7J9GJ54 | 56-140 | None |
| A0A6N2AI94 | 5-78 | None |
| A0A835LTG5 | 3-76 | None |
| A0A7J7HBP5 | 142-217 | None |
| A0A314LB92 | 7-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.