DPCstruct | MC38907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 202 ± 28 aa |
| Standard deviation of domain lengths | 27.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.94 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF15011- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059B133 | 7-231 | RSDSEMEKMLLIYKSFMARVAKSDEVAAAGSRFLASFQQGLELVRRPALDRSSILLKNIIKANETERLTSYFNAGCIHANDGSQNLT… |
| A0A452SXP0 | 156-342 | AVQEALRKCFPVVEEQQGLWQSSLRDCQPLLASLSNLAEQLQAAQNLRFEDVPPLRAFPDLKERLRRKQLAAGDTVLDKLGERLAAL… |
| A0A5A7PEA8 | 54-262 | None |
| A0A2U1PTU0 | 1-260 | None |
| A0A540M4H2 | 135-355 | None |
| A0A6J5UUI9 | 3-202 | None |
| M5FPC6 | 3-220 | None |
| A0A2G8LS54 | 21-211 | None |
| A0A5D2SVG1 | 1-185 | None |
| A0A5N5HK68 | 2-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.