DPCstruct | MC38905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 7.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 20.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2CKE9 | 5-97 | RYDAARSRIQAALAPLECHFTNRDSRGTFAFKAIDPQGVIHFESGRIRTAIYCNPTSLHHLLVAARKKLLAQNIELESWDERLTLEM… |
| A0A0P9S6Q5 | 16-100 | PLRFNDALLIAGHAFEPFQCVAWAPQDGNGELSLTVIDRTSNRIGRKQIPSSTYSDKRQLASALEQARAEISNEGYDLEPWTMPT |
| N2J7P7 | 1-97 | None |
| A0A1G1DXQ5 | 4-78 | None |
| A0A5P2SFG4 | 1-93 | None |
| H8YY74 | 9-94 | None |
| A0A1G3BT13 | 23-99 | None |
| A4VJI7 | 61-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.