DPCstruct | MC38901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 209 ± 16 aa |
| Standard deviation of domain lengths | 16.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 95.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 61.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1HMH6 | 376-590 | PGRRSSSGGSITLKSGKTSGVAINVANTGQLLALLDAAAPGPGGKVVIQATASSGSSQVNISGKVQADRGTVDIRSSGSSGQVNLTN… |
| A0A2V5XCY2 | 1-178 | MLDASGNTGQIVLLASGSNGAINVSGSIQAEQGEVDIRQTGDTGQTTLNNATIHGDVVKLSALGTNGVLNIGSGNMLSADTVLKLYA… |
| A0A2V6C6P1 | 132-341 | None |
| A0A2V6AS90 | 822-1042 | None |
| A0A2V5NDL0 | 53-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.