DPCstruct | MC3890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 130 |
|---|---|
| Mean domain length (aa) | 204 ± 29 aa |
| Standard deviation of domain lengths | 28.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.14 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | PF14067- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F4TPX3 | 33-223 | HSAGLPVIGKWMITPDLKSANWLGQKYQGKEMREPINVIIVDQQAKSIAAAKQNLVVACTMAGYPARWGHSTGYKGYFNGQLAEQLP… |
| B0E3X5 | 20-226 | TADFLTPPDWFAHGLGNSGGVGKGGSIEPINVIISAQSQINPIKALTSFSSFTTCFDWISTLQANVNPGQTTRVNQSVGLRDGGCIQ… |
| A0A6B8TPJ3 | 31-210 | None |
| A0A7V5L5H3 | 259-468 | None |
| A0A4T0HV42 | 33-230 | None |
| A0A4U0W6V3 | 404-646 | None |
| A0A4Y4D487 | 77-295 | None |
| A0A343TJC5 | 30-235 | None |
| A0A539DU12 | 18-215 | None |
| A0A066WM15 | 33-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.