DPCstruct | MC389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 10.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847EJ99 | 78-189 | DELKIEKTGLEAEIKTIHENFARYFVEHEATYLFDGMEETLTMTAADYSADGAAWVITFTFDSRQAGYGDREGQMLAQVITPHEAVL… |
| V6AUY8 | 28-139 | EETQPAQIPLEDAEIAQVTQIALDFVRSSSTFAFDGMEDTLVVDSVHAMESFPVQYRVQISFDSAHGGFGDREGQVLTQVITHHKMD… |
| A0A7J4RVK5 | 45-155 | None |
| A0A419KJC1 | 19-138 | None |
| A0A2G9PW03 | 10-119 | None |
| Q8PW15 | 98-207 | None |
| D1YZI4 | 20-156 | None |
| A0A0M0BIM3 | 150-262 | None |
| A0A3A4VZ29 | 26-127 | None |
| A0A7C3C3N2 | 2-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.