DPCstruct | MC38899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 11.67 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5X1W4 | 1-102 | MRGANLLAIAALPFFPVVPTSSTTVATTGFAGRGSRDTFVTWPIWTGWLALDAARSLFGLKELQGRSETSIKFLEMLGVAATYRSQR… |
| A0A7W8DQR1 | 267-365 | MIGANALAVTGLALHPVHPRQSGLRTTGFTDIDKATTWTWPLWDIPIDIATTRSLIALAESQEDKPDHCQLSPRGVFRLYRCERFTQ… |
| A0A7I7MQE2 | 72-209 | None |
| A0A356EPC3 | 1-87 | None |
| A0A2Z3GU18 | 260-359 | None |
| A0A1E4ZTC6 | 160-254 | None |
| A0A3N1B0D1 | 150-251 | None |
| A0A509Y5C7 | 54-174 | None |
| A0A6L7X7Z7 | 101-200 | None |
| A0A6M5YYP9 | 1177-1277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.