DPCstruct | MC38897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 8.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5WW48 | 2-68 | KEMELYCATHPRSPAAVRRPRLSIRGRTFVALLGPAIEEGIAGFGDSVQAALRAFDAQYSRSLTPPA |
| A0A7Z2LCR7 | 4-89 | QESAYASNIFAMQVTQTATDINYAYTRPSTVFKPALSVDGNQWCALYGTDLQSGVAGFGDTPEKAMQDFDNNWNKPLRNSPSGIAL |
| A0A2V6ECY2 | 2-67 | None |
| A0A5C7QJL3 | 80-152 | None |
| A0A2V5WU88 | 6-79 | None |
| A0A2V5ZPV2 | 13-83 | None |
| A0A4R7WKB7 | 3-77 | None |
| A0A0F9U8Y1 | 2-79 | None |
| A0A7Y4QDT9 | 83-181 | None |
| A0A2V5VDJ2 | 2-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.