DPCstruct | MC38894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 46 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 71.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6CS39 | 2-41 | HVYEVRPRKDRRGFDLISDALQFGRLWYTEIPHAIGYAKF |
| A0A2V5WSC8 | 14-57 | QEMHAYEVRPRKDKRGVDLISDALPFGRLWYGEPNVISNAAGYA |
| A0A2V5RI74 | 3-46 | None |
| A0A2V5RE82 | 23-88 | None |
| A0A2V5WHP8 | 11-59 | None |
| A0A2V5V8J1 | 69-108 | None |
| A0A2V5PBQ5 | 6-48 | None |
| A0A2V5UHI5 | 92-135 | None |
| A0A2V5YWV7 | 6-49 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.