DPCstruct | MC38892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 119 ± 20 aa |
| Standard deviation of domain lengths | 19.81 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522QER0 | 46-157 | NNALSYLRRHGRENPHVRIDRRSMAFHRLIATKIETNPGIVARARDNIDRWSSQGSQEAYLDEWRRILSGDPREIAQFLRSSGQRAT… |
| A0A7W1DCU4 | 16-112 | FIDLFNLMLHRAVAEKLREDAKPVLQIARNNLNRWLKKNENSALLEWRQILETRTPEEIIKIISQDTDEGQRLRSSSPFAGVLSEAE… |
| A0A2Z3QZ16 | 6-137 | None |
| A0A1F4E1I0 | 1-177 | None |
| A0A4Y3KJJ4 | 77-191 | None |
| A0A496WZH9 | 80-215 | None |
| A0A4T0V9Q7 | 56-175 | None |
| A0A085ERQ6 | 1-102 | None |
| A0A4Z0NE85 | 21-142 | None |
| A0A2V2S0S3 | 3-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.