DPCstruct | MC38886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 229 ± 30 aa |
| Standard deviation of domain lengths | 30.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1GNE6 | 27-240 | IGGADGPTAIFLTAMLAPRLIGPIAVAAYSYMALVPVIQPPIMRLLTTRKERLIRMEEPREVSKREKIIFPIVGFLLCCFLAPAALP… |
| A0A841KZI1 | 18-275 | QFGIFTTFLGAVALGFTGAEAASIGIIGGADGPTAIFLTSKLAPHLLGPIAVAAYSYMALVPIIQPPIMRALTTKEERMVKMEQLRP… |
| A0A090RV81 | 30-247 | None |
| A0A1V6K349 | 21-279 | None |
| A0A812RY87 | 690-950 | None |
| A0A2X3FFJ2 | 170-393 | None |
| A0A377VCI0 | 1-185 | None |
| A0A7Z9ZKP9 | 29-248 | None |
| A0A451AYN8 | 242-499 | None |
| A0A7X8MHY5 | 2-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.