DPCstruct | MC38885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 312 ± 31 aa |
| Standard deviation of domain lengths | 30.82 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1FKD0 | 2-311 | RYFADSFRMTIANMPAINLQKLRDLHTDRTVSIGDKLHVVHQRLDEDAATGYSPSTLRVLQKKNGIVIFVHDAFLPPDSHSQADLFA… |
| A0A7W0F1I0 | 8-338 | LLFLLFLLLPFLPGALELSKKEDADPLYIAMDYIRSPRYFSKSFKELIGPALEETNGETGFHEIELSKKETLEICRSMDVPDEKEIH… |
| A0A7C5WD60 | 182-534 | None |
| A0A7G6E067 | 45-341 | None |
| A0A849QS37 | 1-284 | None |
| A0A2N3G5G8 | 2-296 | None |
| A0A1C6L810 | 1-337 | None |
| A0A520JUV7 | 38-298 | None |
| A0A417SAQ3 | 4-341 | None |
| A0A0S8K9P8 | 47-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.