DPCstruct | MC3888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 273 ± 21 aa |
| Standard deviation of domain lengths | 20.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7PGI0 | 375-601 | SHFDTLDDGLGLTAIFAISDIPVDYDPGKLFLLEQNAYVVLKNYTVLVFSGLHRHGGSPPRAPVGAASVEPWALRVTVIWYPSRTFL… |
| B0E2Q4 | 7-284 | VIDTSLVGMGVFGQMHGHRDTGDDAAGYTCMMSNTNVPEGGGTEMGRFFILNNLIYVKMVRFSLPIFNGLFLHGGSPIILGRGIELK… |
| S8DU17 | 6-296 | None |
| A0A0C9X0V2 | 2-288 | None |
| A0A0D7AZL9 | 270-560 | None |
| A0A0C9V4Z7 | 152-413 | None |
| A0A4Y9Y392 | 274-534 | None |
| A0A0H2R206 | 228-495 | None |
| A0A0H2QYX8 | 154-420 | None |
| A0A165XKX4 | 37-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.