DPCstruct | MC38877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A256YTZ5 | 1-90 | MIEGAIVSCVSEGKPLKPVPKLATTVEEIIECAGTRYVYSPNPLAFREALARRVRSLAFVGTPCQIRALDGDYPAEEIRLSPKTLDR… |
| A0A7C5TCB4 | 14-82 | IDGAIVAKSEKEKPFFPRPILATTSEEILQSAGTKYFYSPNILAITKAIEQKKNSAAFVGTPCQIRAIR |
| A0A7J2NLE4 | 511-580 | None |
| A0A355B1R4 | 32-100 | None |
| A0A842R4S2 | 121-196 | None |
| A0A832Z057 | 35-100 | None |
| A0A843K2E3 | 53-133 | None |
| A0A388NVW6 | 32-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.