DPCstruct | MC38875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 547 ± 96 aa |
| Standard deviation of domain lengths | 95.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05925 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C8H423 | 41-533 | SNHSLHNLYNLQRDLLTVAATVLGKQDPVLTSMANQMELAKVKADRPATKQEEAAAKALKKNLIELIAARTQQQDGLPAKEAHRFAA… |
| A0A378YU93 | 113-594 | TPAALPSPGKAVSTRDISRLKELNHWRHEVALAVAKNAKLDLSKFPLTPEPVLAGGERHATQREIAQGAAYPGRLIKDLINAGMGRR… |
| A0A0F5MNS5 | 29-537 | None |
| A0A212KV59 | 193-820 | None |
| A0A1M3CQE8 | 50-633 | None |
| A0A0P6W6E3 | 209-916 | None |
| A0A6L2ZQ28 | 127-735 | None |
| A0A077FJY6 | 49-618 | None |
| A0A1G0HTK8 | 100-560 | None |
| A0A4Q3DKP4 | 4-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.