DPCstruct | MC3887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 172 ± 15 aa |
| Standard deviation of domain lengths | 14.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0E2D0 | 3-144 | EPSFFLHSSVQVLWADASKSKEKSSGAQDGHVVQLKNTCNWKQGNRGGQTPLYPPMFSSSKKNQNPASIKMLELKNFSTTERAITLN… |
| A0A5C3NXD8 | 1-174 | MPEYTEVLACHYTLRRWFDDVKDKTCLKLQGISADGTKAEIQAAKKEDATTRLAQGLVYPLNCTSRIKRGSKTVQQYVWPHIDEQTL… |
| A0A2H3BXT9 | 141-311 | None |
| A0A284QJY6 | 27-198 | None |
| A0A284R6B4 | 1-186 | None |
| B0DCI2 | 19-178 | None |
| A0A4Y9Z5F3 | 13-193 | None |
| A0A166FVM3 | 1-188 | None |
| S7QNV1 | 1-181 | None |
| A0A0C2YAA8 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.