DPCstruct | MC38868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 55 ± 2 aa |
| Standard deviation of domain lengths | 2.42 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 79.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 62.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I2V526 | 1-56 | MPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQCEKYSCLWR |
| A0A2C9KGD0 | 1-55 | MKLQIKRTLTSRSERVKCVDLHPSEPWMLTSLYNGHVYIWNLETKKVIKTLEVSN |
| A0A4S4E2N1 | 3-57 | None |
| A0A4Y2AFY2 | 1-53 | None |
| A0A6A6LIS7 | 320-375 | None |
| B9ILA5 | 3-58 | None |
| A0A817EJF2 | 1-57 | None |
| A0A6P4NM38 | 3-57 | None |
| A0A3Q7J913 | 39-93 | None |
| A0A7J7MB83 | 1-48 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.