DPCstruct | MC38865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 8.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0QRJ9 | 1-94 | MQSCPKCEKKFKWHELFLQSWRGNKRCKNCDTLLQESGKSRWVLILLFFVFSIILLFFSVMVYMNFGVVIWGLIILGFIFGIFSPFF… |
| A0A428MS39 | 15-118 | MREEVMKIQSCVNCKRQFSWREQAKSTRNLFKYPEIECSNCREINKITIPFYILQFFVRAIPVSVLFFLLKSDISNGNRIIIFLICA… |
| A0A2A2IGJ4 | 1-119 | None |
| A0A2I0QR20 | 2-92 | None |
| A0A5D4S000 | 31-142 | None |
| A0A0T6BUE9 | 1-92 | None |
| A0A0M0LNS7 | 8-104 | None |
| A0A562JFL7 | 1-96 | None |
| A0A2E1AUK7 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.