DPCstruct | MC3886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Standard deviation of domain lengths | 11.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0E2R6 | 1-89 | MEIGGPMAALYLLGNPDHYTSHKFVVVYWKNFVREALKPFRSEEDLEEELPEKLVLQKGKGEYVGFSSVHDYIYRPKIFKDKTLYEW… |
| B0DZW6 | 1-109 | MEIGSPMASLYLLGNPDHYTSHKFTLFYWKIYVREAWNAWLDTENNTTESFNTEHKDAPDKAILQKYDGTYIGISSVYDYIYRPTAY… |
| A0A284RWE3 | 357-460 | None |
| A0A067P6W5 | 1-107 | None |
| A0A4Y9Z3Y3 | 3-98 | None |
| A0A4Y9XRZ9 | 44-145 | None |
| A0A165GJ84 | 16-108 | None |
| A0A284RDJ9 | 88-175 | None |
| A0A4S8MKU1 | 1-112 | None |
| A0A2H3BDM0 | 86-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.