DPCstruct | MC38852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 388 ± 77 aa |
| Standard deviation of domain lengths | 77.22 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.00 |
| Pfam Score | 19.44 |
| Assigned Pfam label(s) | PF09660- PF18982- CL0123- PF11855- PF17192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379AJ37 | 1-267 | MSEFSQTVPELVSWARKNDFSLALPVERLAFLLAIATLNGERMDGEMSEGDLIDAFRHVSKAFEQTHETVLVRANNAINDMVRQRLL… |
| A0A2T2XDS2 | 16-384 | LAAPNRRLYARAMVVRDCYRREMKFVRSDLVSYFLNDLQPDLLQQVEPEDDAGELRNLSDRAHLLVRRLIETGWLVTDVDDQTLEET… |
| A0A7J5BNZ3 | 73-633 | None |
| L1KUW1 | 2-346 | None |
| A0A7W5FKI5 | 146-547 | None |
| A0A221W8M4 | 72-553 | None |
| A0A2T4I8C8 | 1-421 | None |
| A0A0R1TPG9 | 1-429 | None |
| A0A2W6VGV3 | 69-551 | None |
| A0A1B8YMX7 | 18-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.