DPCstruct | MC3885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 119 ± 17 aa |
| Standard deviation of domain lengths | 16.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2T0W1 | 2-127 | QLLQLLLATASLSFNHAAVTKRQDGESGFSHGQPISADGKGGPLLGGTNKQVDLDNPSNLGAACTDSGVVPNLKWRFSDSHVKLSNG… |
| B0DZS5 | 1-130 | MHWSLPFLFASCVLLPTVSAIPVPTQVDLGGDPNGIAYTDSNPNKELWHAGSKIVPQPQRGSLGALILGPQNVPLELQNADLLAPPT… |
| A0A2R6QBH0 | 20-128 | None |
| A0A146ICL3 | 213-348 | None |
| A0A2R6PBS0 | 117-207 | None |
| E2LI77 | 1-131 | None |
| A0A135LSW3 | 3-148 | None |
| A0A4Y9Z5U0 | 210-344 | None |
| A0A2R6NRX7 | 13-100 | None |
| M5C2W5 | 7-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.