DPCstruct | MC38847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 270 ± 20 aa |
| Standard deviation of domain lengths | 19.79 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 13.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8B6M7 | 137-402 | LVFHDARGLPVAVPREWEPGTLILADVPVERWADVQVTLNGRPLPVRVERIAGVPRVTVPWDRAGAGRWRVAIHDGAARAEAVIHIR… |
| A0A2M8YX57 | 55-293 | PKEREHVQNSPLQPLFFENEQYEVMVVSKGQKELFLVNEMTGIKQKSRSVYGDGQSILFSTILLQNEIGYTTFHVMSGTEKIIAFTL… |
| A0A3E1ER55 | 38-308 | None |
| A0A6L8BGC8 | 8-292 | None |
| A0A6N0LIK6 | 2-289 | None |
| R7IMV9 | 2-259 | None |
| A0A379AUD5 | 1-298 | None |
| A0A520YYL8 | 9-293 | None |
| A0A0D6KPQ2 | 2-284 | None |
| A0A6H1P6E6 | 13-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.