DPCstruct | MC38846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 86 ± 13 aa |
| Standard deviation of domain lengths | 12.77 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0603 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9B5U0 | 3-83 | LRNDALQMHKENQGKLEVTSKVKVTNKEELSLAYSPGVAEPCKDIHEDKRKVYDYTMKGITVAVVTDGTAVLGLGNIGAEA |
| A0A2M8YWD7 | 108-183 | EEALKTHKEKQGKLGVHSKVEVQSAKDLSLAYSPGVAEPCLEIAEDAEKIYDYTMKGNLVGVVSNGTAVLGLGNIG |
| A0A3D6E1V6 | 6-63 | None |
| A0A2V2G218 | 187-268 | None |
| A0A661NPT9 | 5-86 | None |
| A0A1Q7GIV1 | 471-560 | None |
| A0A1G4UDJ0 | 1-102 | None |
| E7GC99 | 32-115 | None |
| A0A1V3XJ64 | 26-121 | None |
| A0A845X2R6 | 88-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.