DPCstruct | MC38843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Standard deviation of domain lengths | 14.23 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4W8A7 | 34-138 | PAFGFKCDLIRLIASLVHLNPPNQDLVREMDGLLLILESSKFDARNPLIKEASIFALRNLLEGNLENQRCIGELRMEGVAENPGLAE… |
| L1K366 | 35-152 | LSHAQALKTEMGLKCDVIRILANMCYRDRESQDMVRELGGIPLILQASNMDENNPFSREWSILAVRNLCEGNEANQEIIAGIKPKEV… |
| C1E3S1 | 538-643 | None |
| A0A2V2WAQ9 | 62-189 | None |
| A0A3Q0IT58 | 264-386 | None |
| H3B3C6 | 97-224 | None |
| A0A067BN87 | 130-258 | None |
| A0A7J9KS75 | 143-265 | None |
| A0A0S4KKL7 | 238-351 | None |
| A0A0L8VVX2 | 14-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.