DPCstruct | MC38834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 145 ± 28 aa |
| Standard deviation of domain lengths | 27.70 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6FIG5 | 3-152 | FWTEVVRPNSVPTEEPEKLRYNAALLTGSAVVQEYHVMIQEGLEYSYLTNGLALVLLRVPYEDPSILYYHLCEPNMEANQEHSQDFR… |
| A0A7T6XVC4 | 262-420 | KEYKSPRKVKLGHIYGGLEDMDIDKVVEQEKNETLKVRFHRAIAGLLVQPYDYMIRAGTQMGVLSTGEADIYLRIGEDPGTLLYHLS… |
| A0A2S4KX73 | 98-263 | None |
| M1WE35 | 4-76 | None |
| M1WD06 | 135-286 | None |
| M1W6E4 | 296-439 | None |
| A0A1M3SYV9 | 10-146 | None |
| A0A084RLA2 | 614-758 | None |
| A0A2H3GCV1 | 315-476 | None |
| G3JID2 | 277-447 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.