DPCstruct | MC38831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 11.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M6CC48 | 4-90 | QIKSFLLEELTKLQKQFCNIKIKYAFNIAIEVHIVEITPDTEYHSNDRLDESWLNIAMDFMKRFPNEEISFITDDSILKIKSPEFVL |
| A0A353TEX9 | 1-81 | MTPNEFIISKLQSFINDFTETRVRYEHDKLSDTHFVEVVPNEVYHLNERYMAWESKMFDEFVDQFPHENIGFISDDALVGL |
| A0A5R9L1E6 | 2-93 | None |
| A0A413ITV4 | 1-109 | None |
| A0A1V6HZV3 | 3-81 | None |
| A0A851GX85 | 1-93 | None |
| A0A180FC19 | 1-106 | None |
| A0A5S5DWR1 | 1-120 | None |
| A0A1I1WZU9 | 5-96 | None |
| A0A7X8AD09 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.