DPCstruct | MC3883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 182 ± 24 aa |
| Standard deviation of domain lengths | 24.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3LST5 | 272-404 | PFATNSVQYLIATTLNIPFNLTDHQRRDIQQSYAKYLAIEDTRSCLKQLKDDGLWTAKMPVNGDIHEIYISHAGYFKYYHKAFPSVL… |
| B0DWH0 | 20-185 | WSLICLNLEIPVALRHTGNALKLQEHYTCYLALLEAEKKFKKMQKDGTWLAGLRLPVSGEILNLFIGKSTWTKTFPHIAEYPEMVKW… |
| A0A4Y9XSF2 | 68-280 | None |
| A0A0C9WXW6 | 243-425 | None |
| A0A0C9WJ20 | 176-340 | None |
| A0A0C9WJ19 | 46-229 | None |
| A0A409XK81 | 11-212 | None |
| B0DEL2 | 407-593 | None |
| B0D556 | 458-677 | None |
| A0A0C9XB11 | 1-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.