DPCstruct | MC38827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 250 ± 49 aa |
| Standard deviation of domain lengths | 48.60 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A807PIB5 | 3-254 | SNLLFAFTTSAQGLLWGMFALLLGQVFSDASTTKGVTFGLFGLLYIIRMGTDATNLSLGWFNPLSWVYLAFPYVKGHENWTSIILTF… |
| A0A655DXW8 | 4-261 | AGSVAFGVALAASGMVFTAVAAVAAQLSPSARFTRAVAFAVLGTAFALRAIGDAGSGTLSWCSPLGWSLQVRPYAGERWWVLLLSLA… |
| A0A1V0PHD1 | 72-377 | None |
| A0A1H0FNC1 | 13-322 | None |
| F7QVK6 | 1-214 | None |
| A0A1A0JS46 | 132-358 | None |
| A0A6F8Y9U0 | 105-419 | None |
| A0A341FEZ2 | 172-350 | None |
| A0A6V8KYC0 | 2-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.