DPCstruct | MC38823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 448 ± 103 aa |
| Standard deviation of domain lengths | 103.13 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 35.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06101 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q092W7 | 120-578 | RLWVKAATQFHWIYDDAGTGADNDVSIWRPNLSQMPGYVSLGDVAMPSHGQPPRTAFVVSGEGDLLARPIGYTWIWSDWGSGGTHDV… |
| A0A6A4MYW9 | 26-373 | LQVTQISEFNKVWSTRDGGLDNIGATIFEPQNIPEGFYMLGSYSQPNNKALYGWVLVAKDVSSNTTNPTLKQPIDYTLVWSSESLNI… |
| A0A843W6D3 | 39-540 | None |
| A0A5M6DJU3 | 238-826 | None |
| A0A816K863 | 334-875 | None |
| A0A151TWK3 | 1-276 | None |
| A0A1S8LIZ4 | 1-440 | None |
| A0A6A3ASY6 | 37-295 | None |
| A0A2N9GJM1 | 5-349 | None |
| A0A816V8V5 | 680-1209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.