DPCstruct | MC38822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 164 ± 28 aa |
| Standard deviation of domain lengths | 28.27 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.44 |
| Pfam Score | 94.49 |
| Assigned Pfam label(s) | CL0023- PF05128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q091S0 | 692-846 | WVATDMEETAMQSAREARAHEIVKKHSLWALGAGGIPVPGLDIAAFILVQLRMIRELAGHYGMTFNEQAAKGILSSLLGGASAAYLG… |
| A0A645FN29 | 85-212 | EQVSKEADSFIYWAAGRAFAIAIVPLPLADVGPLIANEAYMFYRLGTLYGYAVDKTILAGFLGCLGASVGGKIAASFIPFLKAPIAA… |
| A0A7C3CWQ4 | 31-191 | None |
| A0A7C3CQL3 | 7-168 | None |
| A0A1M7E6I4 | 10-168 | None |
| A0A1L9QT46 | 144-380 | None |
| A0A0B8NY37 | 71-223 | None |
| A0A1X7P9J9 | 40-192 | None |
| S0KSD7 | 33-230 | None |
| M5YC79 | 21-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.