DPCstruct | MC3882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 5.78 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0DW08 | 94-185 | CGVTRCGDGHYRRVVYGLGPYIADYPEQALLACIVQDWCAKCTAPSDNLDGPIGGRRSQALTDTLLEGCTLKELWDDYGIVGDVILV… |
| A0A0C9ZIG9 | 102-196 | IFTSLKLAMTKPEVVRFGDGFYRHMIYSLGPYIADYEEQALLTCIVRCWCPRCLAHRSNLDADALCRCKEFTEALFEERTLAEIWDE… |
| A0A369JD28 | 5-95 | None |
| A0A5M3MSK0 | 252-334 | None |
| A0A5M3MS97 | 5-101 | None |
| A0A1C7LZA3 | 5-101 | None |
| A0A4V3XEF7 | 285-387 | None |
| A0A067PKN8 | 152-243 | None |
| A0A0D0CLR0 | 3-96 | None |
| A0A0D0CG78 | 217-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.