DPCstruct | MC38819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 249 |
|---|---|
| Mean domain length (aa) | 152 ± 21 aa |
| Standard deviation of domain lengths | 21.42 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.99 |
| Pfam Score | 98.57 |
| Assigned Pfam label(s) | CL0023- PF05157 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5ABS4 | 7-133 | QVALARILEQRGLADMAAIDAAAAGGERIAVALVRSGRVEAQAMAEAVAEATGAALVEPAAPVETANIARSFLADRLAAPLGLEEGR… |
| E3FU05 | 11-176 | FRKKRLGEILLDAALLSETQLRTALAEQRKWGGKLGHTLVQMGFVDENSMVHALSRQLQIPSVDLAQVAPPAHVFQLFPAALAERYT… |
| A0A377F9C2 | 230-333 | None |
| A0A1G1K2A7 | 143-281 | None |
| A0A5E9G2W2 | 2-150 | None |
| A0A7V4LZW9 | 53-215 | None |
| A0A847E6X7 | 117-257 | None |
| A0A3A4NTV3 | 1-166 | None |
| A0A076HJN7 | 116-264 | None |
| Q5SLC9 | 158-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.