DPCstruct | MC38814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 131 ± 19 aa |
| Standard deviation of domain lengths | 19.01 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522AS32 | 9-136 | NIFQQLTSVRVVRVSNLAGLYLNGPLNNGVGATLTAPSPAALVIDGVTLALNDRVLLAAQTNANENGIYVVTSTNWVLTRSADQQSI… |
| A0A6B9G469 | 6-137 | TDRLYGLTTSVAVKPAVDISADVNIQLYGPQTITTSTQTGTHTLTTTEGDRVLLTAQDNPIDNGIWISKPATWVRSPDFNGPRDVVN… |
| A0A7Y5LXS1 | 63-225 | None |
| Q602X8 | 228-367 | None |
| A0A1G7ZJ24 | 12-128 | None |
| A0A4Q1UBL0 | 62-176 | None |
| K2D819 | 9-164 | None |
| A0A511QWY7 | 57-191 | None |
| A0A7X6ZPT0 | 14-161 | None |
| W6W1A8 | 152-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.