DPCstruct | MC38809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 247 ± 38 aa |
| Standard deviation of domain lengths | 37.77 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A014PHP2 | 223-488 | MTTDSETVEPSVTSVPSVPKGPSPCAGGCLRDYYSCLLVPDFNHCPTMLNQCLGYNPFYSGKLDLPIATCAKEPTSTSTTRTPTPTP… |
| A0A179HG30 | 1-219 | MKSFVAVTTFAAVALATTPTTAENCAMHCNLAMDGCVATGSPISVCTDVYIECLGYNPYDEVPFTKPTKCHLVGSPEFCADRCNSSM… |
| A0A7J6J8Z0 | 78-369 | None |
| A0A179F4W0 | 1-219 | None |
| A0A0F8A0L9 | 1-204 | None |
| A0A369HBA7 | 1-289 | None |
| A0A0N1HEG8 | 136-420 | None |
| A0A1B8AWD5 | 48-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.