DPCstruct | MC38808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 608 |
|---|---|
| Mean domain length (aa) | 335 ± 76 aa |
| Standard deviation of domain lengths | 76.39 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 12.63 |
| Pfam Score | 93.38 |
| Assigned Pfam label(s) | PF20269- CL0028- PF20270- PF01544- PF11902 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2SYL4 | 74-412 | VWSISAKKTLHFEVFESKPNAKLPTKRTIQDQSTAEQAISVPQSEGFDCKIFCLVQKDSLRPFLITAPLLWNLLDTYKIPAHFLDVL… |
| A0A179H905 | 56-419 | GKAVRDCHVCRSTLSAEFDIPPAWWGEHYLKASSYFGFREIPQSGAKQEGAASWCRFKVKHTASLPKQAEADYHWAKLNVFSRWYKA… |
| A0A084R9I0 | 42-396 | None |
| A0A084RB62 | 71-468 | None |
| A0A084RSL3 | 35-288 | None |
| H0ERL4 | 26-353 | None |
| A0A6G1ILD9 | 7-371 | None |
| A0A6G1IM22 | 710-1166 | None |
| A0A6G1IVD3 | 73-560 | None |
| A0A194UYI0 | 260-557 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.