DPCstruct | MC38807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 189 ± 25 aa |
| Standard deviation of domain lengths | 25.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0MQG0 | 9-187 | AVTSLGVFAAYIAVYRWYVEQRWRRKEALFNFLDSFLDTPGAHNATMMLNSREREIPLWSKSAPEDRYTKVSWGDITAAFTVDNSGA… |
| B0T9C4 | 63-246 | TFTLAVPAAILALYNHRRGLDQQTKAVAQQAASDLWKRREYVAKATAELEADPSNRFAMSLLDYNARRLKLPGSDVLERFDEDDIVL… |
| A0A7L8W164 | 2-153 | None |
| M4Z7G0 | 11-192 | None |
| A0A2V6EWB2 | 2-161 | None |
| A0A2P7SQX3 | 16-216 | None |
| A0A2M6UI46 | 35-219 | None |
| A0A7W9EV47 | 47-230 | None |
| A0A5E7F6Q4 | 184-347 | None |
| A0A2W4UJL1 | 65-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.