DPCstruct | MC38806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 152 ± 14 aa |
| Standard deviation of domain lengths | 14.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0472 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7CSS0 | 1-155 | MVGAGYAGALAVPVLRPLLADARVTGLDPPDLTARVLVRIPVGTVLWEEVAFRGVLPPALRRVLPGRQADAAAAVLFGLWHVAPTLE… |
| A0A2S0KKS1 | 52-213 | LRYSSWVVAGTVAVIAIGLAVPPVREFFHNDAYRELGPALVSALVLIPVLTVIPEELLFRGVLLGALLRRHSEAAAIGVQALLFGLW… |
| A0A1G6NYW9 | 70-216 | None |
| K0ET60 | 443-605 | None |
| A0A1E8PVR4 | 1-118 | None |
| A0A286GP46 | 141-298 | None |
| A0A1X2LRB1 | 21-162 | None |
| L7V6Y5 | 78-239 | None |
| A0A1A2CIX8 | 88-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.