DPCstruct | MC38805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 124 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3F8I4 | 235-345 | RHQALHDECANGNMSACDTLYNTTRDGSAEHAFGDTCGGRTQGGYECTSIGAVSYGDNTHLDRLWDACAAGDGASCDELYTSAPPGS… |
| A0A7V6SHJ6 | 149-274 | PGYGEVGSDTLMDTLVERCHGGEVGACDQLLIAAKMNSGYAREGATCGRGIGPLQGVDDFCAIEDPATFPGYYGRDANLDRLFDSCV… |
| A0A5Q2RM95 | 492-622 | None |
| A0A3S9PYM4 | 1-129 | None |
| A0A511YTN2 | 207-332 | None |
| A0A511FEN9 | 289-411 | None |
| A0A3M2J404 | 335-470 | None |
| A0A662DJY9 | 227-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.