DPCstruct | MC3880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 111 ± 10 aa |
| Standard deviation of domain lengths | 10.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1BXZ0 | 1-115 | MYSKRIAPYGSWESPFSAGMVAAGGTRYSDLVTDGDTVCWIESRPRDAGRCVVVMRAPNGRIADITPQGFQARTRVHEYGGGALALS… |
| B0DIS5 | 1-99 | MVSSTAPYGTWSSPITAQAITKGANGIADVLVDVITSEVYRVENRPSEAGRNVLVHTKLNKDVVGEGWNVRTGVQEYGGLAAVIHAG… |
| A0A093X8B6 | 1-94 | None |
| A0A453DS67 | 10-121 | None |
| A0A835E9I7 | 1-110 | None |
| A0A2X0M5L9 | 6-127 | None |
| A0A812Y6R2 | 677-786 | None |
| A0A0V0I062 | 56-161 | None |
| A0A0R3R877 | 5-112 | None |
| A0A2U1P5B9 | 4-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.