DPCstruct | MC388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 98 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812F475 | 61-160 | KKKKIIAESIEKSKQVYIGKTLEHLAPTVTNFGHQPRDCRFLAEPIDFIAFDGLFNENKVDKITFIDAKTGEADLTPRQKSIRKAVD… |
| A0A7J3XEZ3 | 2-66 | GINPKDVRYLGTPIDFLAFKGLSEGKLERIYFIEVKSGRKLTLSAKEKQIREAIKQRKVDWLLLD |
| A0A1F7LRX3 | 2-91 | None |
| A0A497I6F9 | 84-190 | None |
| A0A382WQ09 | 27-145 | None |
| A0A348VFB7 | 83-191 | None |
| A0A7V2MS72 | 100-208 | None |
| G0HLP6 | 4-83 | None |
| A0A7C5EB59 | 1-57 | None |
| A0A841V8F6 | 3-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.