DPCstruct | MC38799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 207 ± 47 aa |
| Standard deviation of domain lengths | 47.23 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 67.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3QY26 | 1-207 | MSNDSIEPKYQVTKKAPMRRSRAACHKSSDSDDCVKPPTASIATKSAELPKKMSAAQRARNHYHEICGQFRLELKQKLNCEYFVELP… |
| A0A453LUU1 | 1-132 | MCYERESKHCLTGPPLNLVVPHIPPPGQPDQLKVIKVSNVVGINPKPFDPETYMEEDDFITDESKGKKSVHTDVVRCRRAKNADGTE… |
| A0A2S4VI29 | 174-480 | None |
| A0A7J7JAN1 | 8-150 | None |
| A0A812WEI4 | 34-302 | None |
| A0A0E0Q389 | 206-413 | None |
| A0A1E7EVY1 | 81-255 | None |
| A0A1Y2GLR8 | 121-417 | None |
| A0A453BQ98 | 91-286 | None |
| A0A453BQ42 | 11-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.