DPCstruct | MC38793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 117 ± 8 aa |
| Standard deviation of domain lengths | 8.11 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03608 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369AUA9 | 54-166 | KFARMCTKNIFLRYTIFPLLAVFFLTNPMCYSFGRFLDEKQKPAFYDSAVSLVHPITGLFPHANAGELFVWTGISSGLTTLGLSVMP… |
| A0A7H4S432 | 10-127 | QQRIEKLAQRCAGNPISRYLLLPCIGTFVFCNPMTLSLGRFMPEKYKPSYYAAASYSCHSMNGLFPHINPGELFVYLGIANGLTTLG… |
| A0A5S9M984 | 3-115 | None |
| A0A2X1QSL1 | 50-167 | None |
| A0A455T3I4 | 54-166 | None |
| A0A023X4J5 | 77-189 | None |
| A0A7J5NCA9 | 4-112 | None |
| A0A2L0R3W7 | 100-213 | None |
| A0A0K1F275 | 53-166 | None |
| A0A3B8U234 | 37-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.