DPCstruct | MC38791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 95.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4MKP8 | 1-71 | MVWTQTPTQWSNYFFENLFKYEWVQTRSPAGAIQFEAKDAPEIIPDPFNPGKKRKPTMLVTDLTLRFDPGV |
| A0A432VFP9 | 704-770 | WTQQPTKWTNLFFDNLFGHEWELTKSPAGAHQWVAKDAAEDVPDAHIPGKKHRPTMLTTDLSLRFDP |
| A0A212DU93 | 67-136 | None |
| A0A7C7ZAD1 | 306-374 | None |
| A0A3R7DKX3 | 71-140 | None |
| A0A4V3HWL9 | 331-398 | None |
| A0A1D3RPC2 | 98-167 | None |
| A0A377LM11 | 67-131 | None |
| A0A3S4FBP2 | 124-191 | None |
| A0A7K1AMW2 | 162-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.