DPCstruct | MC38790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 198 ± 21 aa |
| Standard deviation of domain lengths | 21.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4MDW7 | 19-213 | QISPAPAVKRVALLGEEYVGMRPAMAVKEGDRVKKGQILFEDKKTPGVYFTAPASGVVSAIHRGERRVLQSVVIDIEGNDAVAFTRY… |
| A0A2I1M536 | 3-189 | KFNLRMGIGAPASPIVKDGDEVKRGQKIADFDPEQLSVPIYSSVNGKVKEVTDEAIYIEKTDDNKEYLKIDKKDNLADVAREAGIIG… |
| A0A845SK44 | 25-229 | None |
| A0A378VTZ2 | 1-189 | None |
| D4J362 | 9-235 | None |
| A0A2T7B5M4 | 32-244 | None |
| A0A110B540 | 212-426 | None |
| R5MBE4 | 21-180 | None |
| A0A1I0BL16 | 591-823 | None |
| A0A7V4NJN4 | 246-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.