DPCstruct | MC3879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 5.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0DIN4 | 1-69 | MLGGRVKTLHPAVHYGILARNIPSDSEDIKAREISPISIVVCNLSPFTETIAKPNCTLAGAVKKSVVVR |
| A0A0N4U6Z9 | 1-73 | MMDGRVKTLHPAIFAGILARNCQSDFNELKQNNFPLISVVVCNLYPFKRTVERADCTLHNAIENIDIGGISLL |
| A0A0F3NI00 | 53-123 | None |
| A0A2N6UXG1 | 2-83 | None |
| A0A444TPZ4 | 1-67 | None |
| A0A317GLI3 | 48-130 | None |
| A0A099DCE0 | 1-76 | None |
| A0A2X1PS32 | 54-135 | None |
| A0A7L9BYN9 | 54-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.