DPCstruct | MC38787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 308 ± 24 aa |
| Standard deviation of domain lengths | 24.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0202- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T4MNY3 | 406-752 | DRCDGELVGTCECGDVKREAATNTSLLRCNSYALVLDSSLTVNFKMTKKNVASFSNVVVKANTAFKGEIEYTEPDKEDATYNQYLVG… |
| A0A1G4WQC3 | 109-423 | AGTLNDGVLTMPAENVTISGKFEFIDGIGARLVGRSITVEDDVSVNFYMELSDEIAQSETAYMQFTIPTGDKTETETVLVSDALQQD… |
| I5AVQ9 | 863-1171 | None |
| R5KI52 | 449-777 | None |
| I5AUA2 | 184-487 | None |
| I5AUY6 | 712-1056 | None |
| I5AUY3 | 464-782 | None |
| A0A416I7S8 | 244-555 | None |
| A0A1M7J2H7 | 497-759 | None |
| R7A533 | 29-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.