DPCstruct | MC38785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 144 ± 32 aa |
| Standard deviation of domain lengths | 32.21 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A330LRA1 | 29-170 | WINDGLMAVCSSPHWCGDWFCYSSVSLTNIQFSDMASVLPIGVALGLFIGKPLGIFSISWFAVRFKISTLPEGVNLKQVFAVSVLCG… |
| A0A7Y3MK11 | 11-129 | PLFALANAGVSFGTDLQIDLQLASTVALSLVLGKMIGVFAFSYIGIKLKVCTLPGDLKLSQIFGASVLAGLGFTMAIFIANLAFKDQ… |
| A0A2S9RHS9 | 4-102 | None |
| A0A357BBE8 | 1-97 | None |
| A0A7C5NCB9 | 1-117 | None |
| A0A5C1IPC2 | 63-204 | None |
| A0A7X4DW45 | 12-156 | None |
| A0A7S2XXH3 | 543-669 | None |
| A0A1H4CUV0 | 6-125 | None |
| A0A7X6UAX8 | 92-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.