DPCstruct | MC38784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 95 ± 19 aa |
| Standard deviation of domain lengths | 18.83 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.17 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | CL0511- CL0167- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847PNR6 | 3-90 | EDKTLICKECGEEFIFTAGEQEFYAEKGFENEPQRCKPCRDARKHAARAGREKYEAVCATCGGIATVLFKPREDRPVYCSECFAKMKE |
| A0A2H0L2F8 | 2-80 | KICTQCTTDFQIAPEDRALYDQLGVTDPTLCPQCRNQCRLAWRNDRTFYRAKSAKSGSPIISMYPPDTQFKIYTPSEWY |
| A0A7V0UA11 | 3-101 | None |
| F6BLX0 | 17-70 | None |
| A0A536DIT2 | 2-105 | None |
| A0A7W0S4K1 | 4-138 | None |
| A0A554JE02 | 3-112 | None |
| A0A7X1PBY1 | 27-138 | None |
| A0A847EJ51 | 3-91 | None |
| A0A0G0NLV5 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.