DPCstruct | MC38782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Standard deviation of domain lengths | 4.89 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 66.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J9T654 | 1-59 | MEAAGTAMYPLHRCKTIYLVRHAQGIHNVEGEKDPSAYMSPTLFDAQLTPLGWKQVDGL |
| A0A540KLP7 | 1-59 | MDATTGPSLYPLHRTKTLHLVRHAQGIHNVEGDKDHAAYMSYDLFDAHLTPLGWSQVIA |
| A0A2G5E7Y6 | 80-141 | None |
| A0A7J8MN57 | 65-121 | None |
| A0A5J5BRT8 | 65-123 | None |
| A0A3S3MCU1 | 1-65 | None |
| A0A833UEV8 | 50-114 | None |
| A0A287GZC2 | 1-50 | None |
| A0A2N9EZZ8 | 1-57 | None |
| A0A067FXN4 | 4-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.